PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G346800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 374aa    MW: 41096.6 Da    PI: 6.1354
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G346800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.28.1e-082321848
                       HTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding 18 qlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       ++G g+W++ +++ g+ R++k+c++rw +yl
  Aqcoe3G346800.1.p  2 RHGHGSWRALPAKAGLQRCGKSCRLRWTNYL 32
                       7****************************97 PP

2Myb_DNA-binding52.98.2e-173883148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
  Aqcoe3G346800.1.p 38 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 83
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512947.669132IPR017930Myb domain
CDDcd001670.00618232No hitNo description
Gene3DG3DSA:1.10.10.605.1E-14239IPR009057Homeodomain-like
PfamPF002493.3E-6232IPR001005SANT/Myb domain
SuperFamilySSF466891.09E-201891IPR009057Homeodomain-like
PROSITE profilePS5129425.8913387IPR017930Myb domain
SMARTSM007171.2E-163785IPR001005SANT/Myb domain
PfamPF002494.4E-163883IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-264087IPR009057Homeodomain-like
CDDcd001675.59E-124083No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000902Biological Processcell morphogenesis
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MRHGHGSWRA LPAKAGLQRC GKSCRLRWTN YLRPDIKRGK FSLQEEQTII QLHALLGNRW  60
SAIATHLPKR TDNEIKNYWN THLKKRLSKL GIDPVTHKPK SDALSSVDGQ TKADSNLSHM  120
AQWESARLEA EARLVRESKL RSTSMNNQLA LSGSGVDLGQ QLNKATSTST QPHCLEVMKA  180
WQGVWSKPTK CGLIAGEGGS SGLDLESPTS TLCFSDNSMP VSTVGFSDNP MSSLDLITNS  240
GTFEGTPVKE ECDEEYKVYE KMNHMGEYKS MVNSVALNTG FHDMGFSTVE SPWAPESSKV  300
GNEHIPVTNF IEGFTNLLLG NSDDRNSLDN SSGDSSDNGD ADATGCEEYE ENKNYWNNIL  360
NLVNSSPSDS PTF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-1828724108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ3249970.0GQ324997.1 Thalictrum dioicum mixta-like2 MYB transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010258286.11e-174PREDICTED: transcription factor MYB34-like
TrEMBLC7EY500.0C7EY50_9MAGN; Mixta-like2 MYB transcription factor (Fragment)
STRINGPOPTR_0017s12230.11e-135(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01140.16e-85myb domain protein 106